Machine Washable Indoor/Outdoor Chantille ACN2207 Gray 8' x 8' Round Rug
Sold out
$0.00 USD
$342.60 USD
Sale 0%
bac_1234Embracethebohemianspiritwithatransitionalpieceadornedinsoft,delicatemotifsthatevokeaworldlyessence.Itsultrathin,flatweaveisUVstabilizedforversatility,perfectforbothindoorandoutdoorspaces,andtheincorporatednon-skidbackingremovesthehassleofaseparatepad.Designedformodernliving,it'smachinewashable,ensuringafamilyandpet-friendlyenvironmentwithoutcompromisingstyle.
UVStabilizedForIndoororOutdoorUse.Allrugsexposedtolongperiodsofintenseanddirectsunlightcanexperiencelossofcolorovertime.Ourrugsperformbestincoveredoutdoorareasanduncoveredareaswithlowerhoursofdirectsunlight.Anultrathinpolyesterflatwovenconstructionwithanincorporatednon-skidbacking.Theultrathinprofileallowsforfastdryingafterrainfalloroutdoorcleaning.MachineWashable.Largerrugsizesmaynotfitintoaresidentialwashingmachine.Theymaybewashedinacommercialsizewashingmachineorhosed-offoutsidewithmildsoapandwater.Air-dry,donotmachinedry.Whileeachrugalreadyhasanon-skidbacking,thenecessityforadditionalcushionorroomsettingswithhightractionareas,mayrequireanadditionalrugpad.FinalcraftinginUSAusingdomesticprocessingonanimportedsubstrate.Specifications:-Box1Height:6.00-PackingTime(days):3-UPC:198590973979-AttributeDimensions(in):0.19,96-DeliveryTime(days):6-Box1Width:6.00-Brand:DalynRugs-AttributeDepth(in):96-Box1Weight:18.00-Box1Depth:96.00-Height:0.19in
Embrace the bohemian spirit with a transitional piece adorned in soft, delicate motifs that evoke a worldly essence. Its ultra thin, flat weave is UV stabilized for versatility, perfect for both indoor and outdoor spaces, and the incorporated non-skid backing removes the hassle of a separate pad. Designed for modern living, it's machine washable, ensuring a family and pet-friendly environment without compromising style.
UV Stabilized For Indoor or Outdoor Use. All rugs exposed to long periods of intense and direct sunlight can experience loss of color over time. Our rugs perform best in covered outdoor areas and uncovered areas with lower hours of direct sunlight. An ultra thin polyester flat woven construction with an incorporated non-skid backing. The ultra thin profile allows for fast drying after rainfall or outdoor cleaning. Machine Washable. Larger rug sizes may not fit into a residential washing machine. They may be washed in a commercial size washing machine or hosed-off outside with mild soap and water. Air-dry, do not machine dry. While each rug already has a non-skid backing, the necessity for additional cushion or room settings with high traction areas, may require an additional rug pad. Final crafting in USA using domestic processing on an imported substrate.
Specifications:
- Box 1 Height : 6.00
- Packing Time (days) : 3
- UPC : 198590973979
- Attribute Dimensions (in) : 0.19, 96
- Delivery Time (days) : 6
- Box 1 Width : 6.00
- Brand : Dalyn Rugs
- Attribute Depth (in) : 96
- Box 1 Weight : 18.00
- Box 1 Depth : 96.00
- Height: 0.19 in
UV Stabilized For Indoor or Outdoor Use. All rugs exposed to long periods of intense and direct sunlight can experience loss of color over time. Our rugs perform best in covered outdoor areas and uncovered areas with lower hours of direct sunlight. An ultra thin polyester flat woven construction with an incorporated non-skid backing. The ultra thin profile allows for fast drying after rainfall or outdoor cleaning. Machine Washable. Larger rug sizes may not fit into a residential washing machine. They may be washed in a commercial size washing machine or hosed-off outside with mild soap and water. Air-dry, do not machine dry. While each rug already has a non-skid backing, the necessity for additional cushion or room settings with high traction areas, may require an additional rug pad. Final crafting in USA using domestic processing on an imported substrate.
Specifications:
- Box 1 Height : 6.00
- Packing Time (days) : 3
- UPC : 198590973979
- Attribute Dimensions (in) : 0.19, 96
- Delivery Time (days) : 6
- Box 1 Width : 6.00
- Brand : Dalyn Rugs
- Attribute Depth (in) : 96
- Box 1 Weight : 18.00
- Box 1 Depth : 96.00
- Height: 0.19 in
Quantity
In stock
Low stock
Out of stock
: left