Machine Washable Indoor/Outdoor Chantille ACN2167 Teal 8' x 10' Rug
Sold out
$0.00 USD
$342.86 USD
Sale 0%
bac_1234Celebrateharmonyandmodernitywithatransitionalworkofartdesignedtocapturetheessenceofoverlappingcirclesandrings,creatingauniquegeometricallure.Idealforbothindoorandoutdoorlivingspaces,itsUVstabilizationaddsversatility,whiletheultra-thin,flatweaveconstructionpromisesdurability.Especiallycraftedforconvenience,itboastsanon-skidbackingandismachinewashable,ensuringafamilyandpet-friendlyenvironmentwithouttheneedforadditionalpadding.
UVStabilizedForIndoororOutdoorUse.Allrugsexposedtolongperiodsofintenseanddirectsunlightcanexperiencelossofcolorovertime.Ourrugsperformbestincoveredoutdoorareasanduncoveredareaswithlowerhoursofdirectsunlight.Anultrathinpolyesterflatwovenconstructionwithanincorporatednon-skidbacking.Theultrathinprofileallowsforfastdryingafterrainfalloroutdoorcleaning.MachineWashable.Largerrugsizesmaynotfitintoaresidentialwashingmachine.Theymaybewashedinacommercialsizewashingmachineorhosed-offoutsidewithmildsoapandwater.Air-dry,donotmachinedry.Whileeachrugalreadyhasanon-skidbacking,thenecessityforadditionalcushionorroomsettingswithhightractionareas,mayrequireanadditionalrugpad.FinalcraftinginUSAusingdomesticprocessingonanimportedsubstrate.Specifications:-Box1Height:8.00-UPC:198590977694-AttributeDimensions(in):0.19,120-Box1Width:8.00-Brand:DalynRugs-AttributeDepth(in):120-Box1Weight:22.00-Box1Depth:96.00-PackingTime(days):3-DeliveryTime(days):6-Height:0.19in
Celebrate harmony and modernity with a transitional work of art designed to capture the essence of overlapping circles and rings, creating a unique geometric allure. Ideal for both indoor and outdoor living spaces, its UV stabilization adds versatility, while the ultra-thin, flat weave construction promises durability. Especially crafted for convenience, it boasts a non-skid backing and is machine washable, ensuring a family and pet-friendly environment without the need for additional padding.
UV Stabilized For Indoor or Outdoor Use. All rugs exposed to long periods of intense and direct sunlight can experience loss of color over time. Our rugs perform best in covered outdoor areas and uncovered areas with lower hours of direct sunlight. An ultra thin polyester flat woven construction with an incorporated non-skid backing. The ultra thin profile allows for fast drying after rainfall or outdoor cleaning. Machine Washable. Larger rug sizes may not fit into a residential washing machine. They may be washed in a commercial size washing machine or hosed-off outside with mild soap and water. Air-dry, do not machine dry. While each rug already has a non-skid backing, the necessity for additional cushion or room settings with high traction areas, may require an additional rug pad. Final crafting in USA using domestic processing on an imported substrate.
Specifications:
- Box 1 Height : 8.00
- UPC : 198590977694
- Attribute Dimensions (in) : 0.19, 120
- Box 1 Width : 8.00
- Brand : Dalyn Rugs
- Attribute Depth (in) : 120
- Box 1 Weight : 22.00
- Box 1 Depth : 96.00
- Packing Time (days) : 3
- Delivery Time (days) : 6
- Height: 0.19 in
UV Stabilized For Indoor or Outdoor Use. All rugs exposed to long periods of intense and direct sunlight can experience loss of color over time. Our rugs perform best in covered outdoor areas and uncovered areas with lower hours of direct sunlight. An ultra thin polyester flat woven construction with an incorporated non-skid backing. The ultra thin profile allows for fast drying after rainfall or outdoor cleaning. Machine Washable. Larger rug sizes may not fit into a residential washing machine. They may be washed in a commercial size washing machine or hosed-off outside with mild soap and water. Air-dry, do not machine dry. While each rug already has a non-skid backing, the necessity for additional cushion or room settings with high traction areas, may require an additional rug pad. Final crafting in USA using domestic processing on an imported substrate.
Specifications:
- Box 1 Height : 8.00
- UPC : 198590977694
- Attribute Dimensions (in) : 0.19, 120
- Box 1 Width : 8.00
- Brand : Dalyn Rugs
- Attribute Depth (in) : 120
- Box 1 Weight : 22.00
- Box 1 Depth : 96.00
- Packing Time (days) : 3
- Delivery Time (days) : 6
- Height: 0.19 in
Quantity
In stock
Low stock
Out of stock
: left