Machine Washable Indoor/Outdoor Chantille ACN2130 Beige 8' x 8' Round Rug
Sold out
$0.00 USD
$342.60 USD
Sale 0%
bac_1234Embracebothstyleandpracticalitywithourcrosshatchweavepatternrugthatbeautifullymarriestransitionaldesignwithversatilestripes.Craftedforconvenience,itsultrathin,flat-wovenconstructionfeaturesanon-skidbacking,eliminatingtheneedforanextrarugpad.UVstabilized,thismachine-washablegemisperfectforbothindoorandoutdoorenjoyment,makingitafamilyandpet-friendlychoice.
UVStabilizedForIndoororOutdoorUse.Allrugsexposedtolongperiodsofintenseanddirectsunlightcanexperiencelossofcolorovertime.Ourrugsperformbestincoveredoutdoorareasanduncoveredareaswithlowerhoursofdirectsunlight.Anultrathinpolyesterflatwovenconstructionwithanincorporatednon-skidbacking.Theultrathinprofileallowsforfastdryingafterrainfalloroutdoorcleaning.MachineWashable.Largerrugsizesmaynotfitintoaresidentialwashingmachine.Theymaybewashedinacommercialsizewashingmachineorhosed-offoutsidewithmildsoapandwater.Air-dry,donotmachinedry.Whileeachrugalreadyhasanon-skidbacking,thenecessityforadditionalcushionorroomsettingswithhightractionareas,mayrequireanadditionalrugpad.FinalcraftinginUSAusingdomesticprocessingonanimportedsubstrate.Specifications:-Box1Height:6.00-UPC:198590970541-AttributeDimensions(in):0.19,96-Box1Width:6.00-Brand:DalynRugs-AttributeDepth(in):96-Box1Weight:18.00-Box1Depth:96.00-PackingTime(days):3-DeliveryTime(days):6-Height:0.19in
Embrace both style and practicality with our cross hatch weave pattern rug that beautifully marries transitional design with versatile stripes. Crafted for convenience, its ultra thin, flat-woven construction features a non-skid backing, eliminating the need for an extra rug pad. UV stabilized, this machine-washable gem is perfect for both indoor and outdoor enjoyment, making it a family and pet-friendly choice.
UV Stabilized For Indoor or Outdoor Use. All rugs exposed to long periods of intense and direct sunlight can experience loss of color over time. Our rugs perform best in covered outdoor areas and uncovered areas with lower hours of direct sunlight. An ultra thin polyester flat woven construction with an incorporated non-skid backing. The ultra thin profile allows for fast drying after rainfall or outdoor cleaning. Machine Washable. Larger rug sizes may not fit into a residential washing machine. They may be washed in a commercial size washing machine or hosed-off outside with mild soap and water. Air-dry, do not machine dry. While each rug already has a non-skid backing, the necessity for additional cushion or room settings with high traction areas, may require an additional rug pad. Final crafting in USA using domestic processing on an imported substrate.
Specifications:
- Box 1 Height : 6.00
- UPC : 198590970541
- Attribute Dimensions (in) : 0.19, 96
- Box 1 Width : 6.00
- Brand : Dalyn Rugs
- Attribute Depth (in) : 96
- Box 1 Weight : 18.00
- Box 1 Depth : 96.00
- Packing Time (days) : 3
- Delivery Time (days) : 6
- Height: 0.19 in
UV Stabilized For Indoor or Outdoor Use. All rugs exposed to long periods of intense and direct sunlight can experience loss of color over time. Our rugs perform best in covered outdoor areas and uncovered areas with lower hours of direct sunlight. An ultra thin polyester flat woven construction with an incorporated non-skid backing. The ultra thin profile allows for fast drying after rainfall or outdoor cleaning. Machine Washable. Larger rug sizes may not fit into a residential washing machine. They may be washed in a commercial size washing machine or hosed-off outside with mild soap and water. Air-dry, do not machine dry. While each rug already has a non-skid backing, the necessity for additional cushion or room settings with high traction areas, may require an additional rug pad. Final crafting in USA using domestic processing on an imported substrate.
Specifications:
- Box 1 Height : 6.00
- UPC : 198590970541
- Attribute Dimensions (in) : 0.19, 96
- Box 1 Width : 6.00
- Brand : Dalyn Rugs
- Attribute Depth (in) : 96
- Box 1 Weight : 18.00
- Box 1 Depth : 96.00
- Packing Time (days) : 3
- Delivery Time (days) : 6
- Height: 0.19 in
Quantity
In stock
Low stock
Out of stock
: left