Machine Washable Indoor/Outdoor Chantille ACN2059 Blue 8' x 8' Round Rug
Sold out
$0.00 USD
$342.60 USD
Sale 0%
bac_1234Discovertheperfectharmonyoftransitionalstyleandmodernartistrywithacaptivatingabstractdesignthatfeaturesauniquesplit,addingadynamicedgetoyourdécor.Itsultra-thin,flat-wovenconstruction,pairedwithUVstabilization,offersversatileplacementoptionsindoorsoroutdoors,whilethenon-skidbackingremovesthehassleofpurchasinganadditionalrugpad.Designedwithbusyhouseholdsinmind,theconvenienceofmachinewashingmakesitafamilyandpet-friendlyoption,mergingpracticalitywithartisticflair.
UVStabilizedForIndoororOutdoorUse.Allrugsexposedtolongperiodsofintenseanddirectsunlightcanexperiencelossofcolorovertime.Ourrugsperformbestincoveredoutdoorareasanduncoveredareaswithlowerhoursofdirectsunlight.Anultrathinpolyesterflatwovenconstructionwithanincorporatednon-skidbacking.Theultrathinprofileallowsforfastdryingafterrainfalloroutdoorcleaning.MachineWashable.Largerrugsizesmaynotfitintoaresidentialwashingmachine.Theymaybewashedinacommercialsizewashingmachineorhosed-offoutsidewithmildsoapandwater.Air-dry,donotmachinedry.Whileeachrugalreadyhasanon-skidbacking,thenecessityforadditionalcushionorroomsettingswithhightractionareas,mayrequireanadditionalrugpad.FinalcraftinginUSAusingdomesticprocessingonanimportedsubstrate.Specifications:-Box1Height:6.00-PackingTime(days):3-UPC:198590878649-AttributeDimensions(in):0.19,96-DeliveryTime(days):6-Box1Width:6.00-Brand:DalynRugs-AttributeDepth(in):96-Box1Weight:18.00-Box1Depth:96.00-Height:0.19in
Discover the perfect harmony of transitional style and modern artistry with a captivating abstract design that features a unique split, adding a dynamic edge to your décor. Its ultra-thin, flat-woven construction, paired with UV stabilization, offers versatile placement options indoors or outdoors, while the non-skid backing removes the hassle of purchasing an additional rug pad. Designed with busy households in mind, the convenience of machine washing makes it a family and pet-friendly option, merging practicality with artistic flair.
UV Stabilized For Indoor or Outdoor Use. All rugs exposed to long periods of intense and direct sunlight can experience loss of color over time. Our rugs perform best in covered outdoor areas and uncovered areas with lower hours of direct sunlight. An ultra thin polyester flat woven construction with an incorporated non-skid backing. The ultra thin profile allows for fast drying after rainfall or outdoor cleaning. Machine Washable. Larger rug sizes may not fit into a residential washing machine. They may be washed in a commercial size washing machine or hosed-off outside with mild soap and water. Air-dry, do not machine dry. While each rug already has a non-skid backing, the necessity for additional cushion or room settings with high traction areas, may require an additional rug pad. Final crafting in USA using domestic processing on an imported substrate.
Specifications:
- Box 1 Height : 6.00
- Packing Time (days) : 3
- UPC : 198590878649
- Attribute Dimensions (in) : 0.19, 96
- Delivery Time (days) : 6
- Box 1 Width : 6.00
- Brand : Dalyn Rugs
- Attribute Depth (in) : 96
- Box 1 Weight : 18.00
- Box 1 Depth : 96.00
- Height: 0.19 in
UV Stabilized For Indoor or Outdoor Use. All rugs exposed to long periods of intense and direct sunlight can experience loss of color over time. Our rugs perform best in covered outdoor areas and uncovered areas with lower hours of direct sunlight. An ultra thin polyester flat woven construction with an incorporated non-skid backing. The ultra thin profile allows for fast drying after rainfall or outdoor cleaning. Machine Washable. Larger rug sizes may not fit into a residential washing machine. They may be washed in a commercial size washing machine or hosed-off outside with mild soap and water. Air-dry, do not machine dry. While each rug already has a non-skid backing, the necessity for additional cushion or room settings with high traction areas, may require an additional rug pad. Final crafting in USA using domestic processing on an imported substrate.
Specifications:
- Box 1 Height : 6.00
- Packing Time (days) : 3
- UPC : 198590878649
- Attribute Dimensions (in) : 0.19, 96
- Delivery Time (days) : 6
- Box 1 Width : 6.00
- Brand : Dalyn Rugs
- Attribute Depth (in) : 96
- Box 1 Weight : 18.00
- Box 1 Depth : 96.00
- Height: 0.19 in
Quantity
In stock
Low stock
Out of stock
: left